PDB entry 3li2

View 3li2 on RCSB PDB site
Description: Closed Conformation of HtsA Complexed with Staphyloferrin A
Class: transport protein
Keywords: siderophore, iron, receptor, lipoprotein, binding protein, TRANSPORT PROTEIN
Deposited on 2010-01-23, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.168
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrichrome ABC transporter lipoprotein
    Species: Staphylococcus aureus subsp. aureus [TaxId:426430]
    Gene: htsA, NWMN_2078
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QJ18 (7-End)
      • expression tag (4-6)
    Domains in SCOPe 2.07: d3li2a1, d3li2a2
  • Chain 'B':
    Compound: Ferrichrome ABC transporter lipoprotein
    Species: Staphylococcus aureus subsp. aureus [TaxId:426430]
    Gene: htsA, NWMN_2078
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QJ18 (7-End)
      • expression tag (4-6)
    Domains in SCOPe 2.07: d3li2b1, d3li2b2
  • Heterogens: FE, SF8, ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3li2A (A:)
    gshmastisvkdengtvkvpkdakrivvleysfadalaaldvkpvgiaddgkkkriikpv
    rekigdytsvgtrkqpnleeisklkpdliiadssrhkginkelnkiaptlslksfdgdyk
    qninsfktiakalnkekegekrlaehdklinkykdeikfdrnqkvlpavvakagllahpn
    ysyvgqflnelgfknalsddvtkglskylkgpylqldtehladlnpermiimtdhakkds
    aefkklqedatwkklnavknnrvdivdrdvwarsrglisseemakelvelskkeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3li2A (A:)
    astisvkdengtvkvpkdakrivvleysfadalaaldvkpvgiaddgkkkriikpvreki
    gdytsvgtrkqpnleeisklkpdliiadssrhkginkelnkiaptlslksfdgdykqnin
    sfktiakalnkekegekrlaehdklinkykdeikfdrnqkvlpavvakagllahpnysyv
    gqflnelgfknalsddvtkglskylkgpylqldtehladlnpermiimtdhakkdsaefk
    klqedatwkklnavknnrvdivdrdvwarsrglisseemakelvelsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3li2B (B:)
    gshmastisvkdengtvkvpkdakrivvleysfadalaaldvkpvgiaddgkkkriikpv
    rekigdytsvgtrkqpnleeisklkpdliiadssrhkginkelnkiaptlslksfdgdyk
    qninsfktiakalnkekegekrlaehdklinkykdeikfdrnqkvlpavvakagllahpn
    ysyvgqflnelgfknalsddvtkglskylkgpylqldtehladlnpermiimtdhakkds
    aefkklqedatwkklnavknnrvdivdrdvwarsrglisseemakelvelskkeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3li2B (B:)
    astisvkdengtvkvpkdakrivvleysfadalaaldvkpvgiaddgkkkriikpvreki
    gdytsvgtrkqpnleeisklkpdliiadssrhkginkelnkiaptlslksfdgdykqnin
    sfktiakalnkekegekrlaehdklinkykdeikfdrnqkvlpavvakagllahpnysyv
    gqflnelgfknalsddvtkglskylkgpylqldtehladlnpermiimtdhakkdsaefk
    klqedatwkklnavknnrvdivdrdvwarsrglisseemakelvelskk