PDB entry 3lhs

View 3lhs on RCSB PDB site
Description: Open Conformation of HtsA Complexed with Staphyloferrin A
Class: transport protein
Keywords: siderophore, iron, receptor, lipoprotein, binding protein, TRANSPORT PROTEIN
Deposited on 2010-01-23, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrichrome ABC transporter lipoprotein
    Species: Staphylococcus aureus subsp. aureus strain [TaxId:426430]
    Gene: htsA, NWMN_2078
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QJ18 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.07: d3lhsa1, d3lhsa2
  • Heterogens: GOL, FE, SF8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lhsA (A:)
    gshmastisvkdengtvkvpkdakrivvleysfadalaaldvkpvgiaddgkkkriikpv
    rekigdytsvgtrkqpnleeisklkpdliiadssrhkginkelnkiaptlslksfdgdyk
    qninsfktiakalnkekegekrlaehdklinkykdeikfdrnqkvlpavvakagllahpn
    ysyvgqflnelgfknalsddvtkglskylkgpylqldtehladlnpermiimtdhakkds
    aefkklqedatwkklnavknnrvdivdrdvwarsrglisseemakelvelskkeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lhsA (A:)
    astisvkdengtvkvpkdakrivvleysfadalaaldvkpvgiaddgkkkriikpvreki
    gdytsvgtrkqpnleeisklkpdliiadssrhkginkelnkiaptlslksfdgdykqnin
    sfktiakalnkekegekrlaehdklinkykdeikfdrnqkvlpavvakagllahpnysyv
    gqflnelgfknalsddvtkglskylkgpylqldtehladlnpermiimtdhakkdsaefk
    klqedatwkklnavknnrvdivdrdvwarsrglisseemakelvelskkeq