PDB entry 3lhm

View 3lhm on RCSB PDB site
Description: crystal structures of the apo-and holomutant human lysozymes with an introduced ca2+ binding site
Deposited on 1991-10-02, released 1992-04-15
The last revision prior to the SCOP 1.69 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-26.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.165
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d3lhm__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lhm_ (-)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavnachlscsallddniaddvacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv