PDB entry 3lgk

View 3lgk on RCSB PDB site
Description: D99N Epi-isozizaene synthase
Class: lyase
Keywords: terpenoid cyclase, alpha-helical fold, farnesyl diphosphate, metal-binding, Magnesium, LYASE
Deposited on 2010-01-20, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.164
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epi-isozizaene synthase
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: cyc1, SCO5222, SC7E4.19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K499
      • engineered (119)
    Domains in SCOPe 2.07: d3lgka_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lgkA (A:)
    mgsshhhhhhssglvprgshmvhafphgttatptaiavppslrlpvieaafprqlhpywp
    klqettrtwllekrlmpadkveeyadglcytdlmagyylgapdevlqaiadysawffvwn
    drhdrdivhgragawrrlrgllhtaldspgdhlhhedtlvagfadsvrrlyaflpatwna
    rfarhfhtvieaydrefhnrtrgivpgveeylelrrltfahwiwtdllepssgcelpdav
    rkhpayrraallsqefaawyndlcslpkeiagdevhnlgislithhsltleeaigevrrr
    veeciteflaverdalrfadeladgtvrgkelsgavranvgnmrnwfssvywfhhesgry
    mvdswddrstppyvnneaagek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lgkA (A:)
    ppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmagyy
    lgapdevlqaiadysawffvwndrhdrdivhgragawrrlrgllhtaldspgdhlhhedt
    lvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgveeylelrrlt
    fahwiwtdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkeiagdevhnl
    gislithhsltleeaigevrrrveeciteflaverdalrfadeladgtvrgkelsgavra
    nvgnmrnwfssvywfhhe