PDB entry 3lev

View 3lev on RCSB PDB site
Description: HIV-1 antibody 2F5 in complex with epitope scaffold ES2
Class: immune system
Keywords: hiv-1, gp41, monoclonal antibody, 2f5, scaffold, epitope, transplant, graft, sigma factor, re-elicitation, immune system, vaccine design
Deposited on 2010-01-15, released 2010-09-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase sigma factor
    Species: Thermus aquaticus [TaxId:271]
    Gene: SIGMA FACTOR SIGA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EZJ8 (0-End)
      • engineered (12)
      • engineered (14-15)
      • engineered (17-20)
      • engineered (22-24)
      • engineered (26)
      • engineered (62)
      • engineered (154)
      • engineered (156)
  • Chain 'H':
    Compound: 2f5 antibody heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LEV (0-236)
    Domains in SCOPe 2.06: d3levh1, d3levh2
  • Chain 'L':
    Compound: 2f5 antibody light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3LEV (0-213)
    Domains in SCOPe 2.06: d3levl1, d3levl2
  • Heterogens: 1PE, ATP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3levH (H:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3levL (L:)
    alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
    rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvrrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec