PDB entry 3lei

View 3lei on RCSB PDB site
Description: Lectin Domain of Lectinolysin complexed with Fucose
Class: blood clotting
Keywords: lectin domain of lectinolysin, fucose, BLOOD CLOTTING, nickel
Deposited on 2010-01-14, released 2010-12-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Platelet aggregation factor Sm-hPAF
    Species: Streptococcus mitis [TaxId:28037]
    Gene: samhpaf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2PHL4
      • see remark 999 (29)
      • see remark 999 (120)
    Domains in SCOPe 2.04: d3leia_
  • Heterogens: FUC, CA, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3leiA (A:)
    eqgnrpveteniargkqasqsstayggaatravdgnvdsdyghhsvthtnfednawwqvd
    lgktenvgkvklynrgdgnvanrlsnfdvvllneakqevarqhfdslngkaelevfftak
    daryvkvelktkntplslaevevfrsattqvgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3leiA (A:)
    pveteniargkqasqsstayggaatravdgnvdsdyghhsvthtnfednawwqvdlgkte
    nvgkvklynrgdgnvanrlsnfdvvllneakqevarqhfdslngkaelevfftakdaryv
    kvelktkntplslaevevfrsat