PDB entry 3le3

View 3le3 on RCSB PDB site
Description: Crystal structure of apoHPr monomer from Thermoanaerobacter tengcongensis
Class: transferase
Keywords: HPr PTS phosphotransferase, Kinase, Phosphotransferase system, Transferase
Deposited on 2010-01-14, released 2010-12-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphotransferase system, HPr-related proteins
    Species: Thermoanaerobacter tengcongensis [TaxId:273068]
    Gene: FruB, TTE1820
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3le3a_
  • Chain 'B':
    Compound: Phosphotransferase system, HPr-related proteins
    Species: Thermoanaerobacter tengcongensis [TaxId:273068]
    Gene: FruB, TTE1820
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3le3b_
  • Chain 'C':
    Compound: Phosphotransferase system, HPr-related proteins
    Species: Thermoanaerobacter tengcongensis [TaxId:273068]
    Gene: FruB, TTE1820
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3le3c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3le3A (A:)
    mkevtieiknktglharpaalfvqtaskfssqiwvekdnkkvnaksimgimslgvsqgnv
    vklsaegddeeeaikalvdlieskfgee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3le3B (B:)
    mkevtieiknktglharpaalfvqtaskfssqiwvekdnkkvnaksimgimslgvsqgnv
    vklsaegddeeeaikalvdlieskfgee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3le3C (C:)
    mkevtieiknktglharpaalfvqtaskfssqiwvekdnkkvnaksimgimslgvsqgnv
    vklsaegddeeeaikalvdlieskfgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3le3C (C:)
    mkevtieiknktglharpaalfvqtaskfssqiwvekdnkkvnaksimgimslgvsqgnv
    vklsaegddeeeaikalvdlieskfge