PDB entry 3le0

View 3le0 on RCSB PDB site
Description: Lectin Domain of Lectinolysin complexed with Glycerol
Class: blood clotting
Keywords: lectin domain of lectinolysin, BLOOD CLOTTING, glycerol, nickel
Deposited on 2010-01-13, released 2010-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Platelet aggregation factor Sm-hPAF
    Species: Streptococcus mitis [TaxId:28037]
    Gene: samhpaf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2PHL4
      • see remark 999 (29)
      • see remark 999 (120)
    Domains in SCOPe 2.07: d3le0a_
  • Heterogens: CA, NI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3le0A (A:)
    eqgnrpveteniargkqasqsstayggaatravdgnvdsdyghhsvthtnfednawwqvd
    lgktenvgkvklynrgdgnvanrlsnfdvvllneakqevarqhfdslngkaelevfftak
    daryvkvelktkntplslaevevfrsattqvgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3le0A (A:)
    veteniargkqasqsstayggaatravdgnvdsdyghhsvthtnfednawwqvdlgkten
    vgkvklynrgdgnvanrlsnfdvvllneakqevarqhfdslngkaelevfftakdaryvk
    velktkntplslaevevfrsat