PDB entry 3ldb

View 3ldb on RCSB PDB site
Description: Structure of JMJD6 complexd with ALPHA-KETOGLUTARATE and Fab Fragment.
Class: immune system
Keywords: JMJ6D, ALPHA-KETOGLUTARATE, Fab Fragments, IMMUNE SYSTEM
Deposited on 2010-01-12, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.25
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
    Species: Homo sapiens [TaxId:9606]
    Gene: JMJD6, JMJD6 (1-403), KIAA0585, PTDSR
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: antibody fab fragment light chain
    Species: Cricetulus migratorius [TaxId:10032]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3LDB (0-End)
    Domains in SCOPe 2.07: d3ldbb1, d3ldbb2
  • Chain 'C':
    Compound: antibody fab fragment heavy chain
    Species: Cricetulus migratorius [TaxId:10032]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3LDB (0-End)
  • Heterogens: GOL, SO4, AKG, FE, HG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ldbB (B:)
    divmtqspsslavsagekvtmscrssqslyysgikknllawyqlkpgqspklliyyastl
    ftgvpdrftgsgsgtdytltitsvqaedmgqyfcqqgisnpytfgagtkleikradakpt
    vsifppsseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqdskdstys
    lsstlsltkadyerhnlytcevthktstaaivktlnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ldbB (B:)
    divmtqspsslavsagekvtmscrssqslyysgikknllawyqlkpgqspklliyyastl
    ftgvpdrftgsgsgtdytltitsvqaedmgqyfcqqgisnpytfgagtkleikradakpt
    vsifppsseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqdskdstys
    lsstlsltkadyerhnlytcevthktstaaivktlnr
    

  • Chain 'C':
    No sequence available.