PDB entry 3lc3

View 3lc3 on RCSB PDB site
Description: Benzothiophene Inhibitors of Factor IXa
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Protein-Inhibitor complex, Peptidase S1, Blood coagulation, Calcium, Cleavage on pair of basic residues, Disease mutation, Disulfide bond, EGF-like domain, Gamma-carboxyglutamic acid, Glycoprotein, Hemophilia, Hydrolase, Hydroxylation, Pharmaceutical, Phosphoprotein, Polymorphism, Protease, Secreted, Serine protease, Sulfation, Zymogen, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2010-01-09, released 2010-02-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coagulation factor ix
    Species: Homo sapiens [TaxId:9606]
    Gene: F9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lc3a_
  • Chain 'B':
    Compound: coagulation factor ix
    Species: Homo sapiens [TaxId:9606]
    Gene: F9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00740 (1-56)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d3lc3b_
  • Chain 'C':
    Compound: coagulation factor ix
    Species: Homo sapiens [TaxId:9606]
    Gene: F9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lc3c_
  • Chain 'D':
    Compound: coagulation factor ix
    Species: Homo sapiens [TaxId:9606]
    Gene: F9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00740 (1-56)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d3lc3d_
  • Heterogens: IYX, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lc3A (A:)
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lc3B (B:)
mtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtsk

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lc3C (C:)
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lc3D (D:)
mtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtsk