PDB entry 3lb6

View 3lb6 on RCSB PDB site
Description: The structure of IL-13 in complex with IL-13Ralpha2
Class: signaling protein/signaling protein
Keywords: cytokine, receptor, decoy, decoy receptor, Glycoprotein, Secreted, signaling protein-signaling protein complex
Deposited on 2010-01-07, released 2010-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.222
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-13
    Species: Homo sapiens [TaxId:9606]
    Gene: IL13, NC30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lb6a_
  • Chain 'B':
    Compound: interleukin-13
    Species: Homo sapiens [TaxId:9606]
    Gene: IL13, NC30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3lb6b_
  • Chain 'C':
    Compound: Interleukin-13 receptor subunit alpha-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8K7E2
      • engineered (150)
  • Chain 'D':
    Compound: Interleukin-13 receptor subunit alpha-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8K7E2
      • engineered (150)
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lb6A (A:)
    malllttvialtclggfaspgpvppstalrelieelvnitqnqkaplcngsmvwsinlta
    gmycaaleslinvsgcsaiektqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlll
    hlkklfregrfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lb6A (A:)
    ppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektq
    rmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lb6B (B:)
    malllttvialtclggfaspgpvppstalrelieelvnitqnqkaplcngsmvwsinlta
    gmycaaleslinvsgcsaiektqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlll
    hlkklfregrfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lb6B (B:)
    ppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektq
    rmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.