PDB entry 3law

View 3law on RCSB PDB site
Description: Structure of GTP-bound L129F mutant Rab7
Class: proton transport
Keywords: Protein - Nucleotide complex, Protein Mutant, Charcot-Marie-Tooth disease, Cytoplasmic vesicle, Disease mutation, Endosome, GTP-binding, Lipoprotein, Lysosome, Methylation, Neuropathy, Nucleotide-binding, Phosphoprotein, Prenylation, Protein transport, PROTON TRANSPORT
Deposited on 2010-01-07, released 2010-01-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-7a
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB7A, RAB7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51149
      • engineered (128)
    Domains in SCOPe 2.04: d3lawa_
  • Chain 'B':
    Compound: Ras-related protein Rab-7a
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB7A, RAB7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51149
      • engineered (128)
    Domains in SCOPe 2.04: d3lawb_
  • Chain 'C':
    Compound: Ras-related protein Rab-7a
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB7A, RAB7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51149
      • engineered (128)
    Domains in SCOPe 2.04: d3lawc_
  • Chain 'D':
    Compound: Ras-related protein Rab-7a
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB7A, RAB7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51149
      • engineered (128)
    Domains in SCOPe 2.04: d3lawd_
  • Chain 'E':
    Compound: Ras-related protein Rab-7a
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB7A, RAB7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51149
      • engineered (128)
    Domains in SCOPe 2.04: d3lawe_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3lawA (A:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidfenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldkndrakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lawA (A:)
    kvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdta
    gqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgn
    kidfenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3lawB (B:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidfenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldkndrakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lawB (B:)
    kvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdta
    gqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgn
    kidfenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3lawC (C:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidfenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldkndrakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lawC (C:)
    kkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdt
    agqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlg
    nkidfenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqeteve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3lawD (D:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidfenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldkndrakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lawD (D:)
    kkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdt
    agqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlg
    nkidfenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3lawE (E:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidfenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldkndrakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3lawE (E:)
    kvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdta
    gqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgn
    kidfenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev