PDB entry 3l9y

View 3l9y on RCSB PDB site
Description: Crystal structures of holo and Cu-deficient Cu/ZnSOD from the silkworm Bombyx mori and the implications in Amyotrophic lateral sclerosis
Class: oxidoreductase
Keywords: Greek-key-barrel, Antioxidant, Copper, Cytoplasm, Metal-binding, Oxidoreductase
Deposited on 2010-01-06, released 2010-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bombyx mori [TaxId:7091]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82205 (Start-153)
      • engineered (91)
      • engineered (130)
    Domains in SCOPe 2.07: d3l9ya_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bombyx mori [TaxId:7091]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82205 (0-153)
      • engineered (91)
      • engineered (130)
    Domains in SCOPe 2.07: d3l9yb_
  • Heterogens: ZN, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l9yA (A:)
    mpakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsag
    ahfnpekqdhggpssavrhvgdlgnieaiedagvtkvsiqdsqislhgpnsiigrtlvvh
    adpddlglggnelskttgnaggriacgviglaki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l9yA (A:)
    pakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsaga
    hfnpekqdhggpssavrhvgdlgnieaiedagvtkvsiqdsqislhgpnsiigrtlvvha
    dpddlglggnelskttgnaggriacgviglaki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l9yB (B:)
    mpakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsag
    ahfnpekqdhggpssavrhvgdlgnieaiedagvtkvsiqdsqislhgpnsiigrtlvvh
    adpddlglggnelskttgnaggriacgviglaki