PDB entry 3l9r

View 3l9r on RCSB PDB site
Description: Crystal structure of bovine CD1b3 with endogenously bound ligands
Class: Immune Response
Keywords: antigen presentation, cattle, CD1, Immune response, Immunoglobulin domain, MHC I
Deposited on 2010-01-05, released 2010-06-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD1b3
    Species: Bos taurus [TaxId:9913]
    Gene: CD1B3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1L1H6 (Start-276)
      • expression tag (277)
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Bos taurus [TaxId:9913]
    Gene: B2M, beta-2-microglobulin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3l9rb_
  • Chain 'C':
    Compound: CD1b3
    Species: Bos taurus [TaxId:9913]
    Gene: CD1B3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1L1H6 (Start-276)
      • expression tag (277)
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Bos taurus [TaxId:9913]
    Gene: B2M, beta-2-microglobulin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3l9rd_
  • Chain 'E':
    Compound: CD1b3
    Species: Bos taurus [TaxId:9913]
    Gene: CD1B3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1L1H6 (Start-276)
      • expression tag (277)
  • Chain 'F':
    Compound: Beta-2-microglobulin
    Species: Bos taurus [TaxId:9913]
    Gene: B2M, beta-2-microglobulin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3l9rf_
  • Chain 'G':
    Compound: CD1b3
    Species: Bos taurus [TaxId:9913]
    Gene: CD1B3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1L1H6 (Start-276)
      • expression tag (277)
  • Chain 'H':
    Compound: Beta-2-microglobulin
    Species: Bos taurus [TaxId:9913]
    Gene: B2M, beta-2-microglobulin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3l9rh_
  • Heterogens: NAG, L9R, GOL, L9Q, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l9rB (B:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l9rB (B:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrd
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l9rD (D:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l9rF (F:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l9rH (H:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl