PDB entry 3l9e

View 3l9e on RCSB PDB site
Description: Crystal structures of holo and Cu-deficient Cu/ZnSOD from the silkworm Bombyx mori and the implications in Amyotrophic lateral sclerosis
Class: oxidoreductase
Keywords: Greek-key-barrel, Antioxidant, Cytoplasm, Disulfide bond, Metal-binding, Oxidoreductase, Zinc
Deposited on 2010-01-05, released 2010-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.203
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bombyx mori [TaxId:7091]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l9ea_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bombyx mori [TaxId:7091]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l9eb_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bombyx mori [TaxId:7091]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l9ec_
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bombyx mori [TaxId:7091]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l9ed_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l9eA (A:)
    mpakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsag
    ahfnpekqdhggpssavrhvgdlgnieaiedsgvtkvsiqdsqislhgpnsiigrtlvvh
    adpddlglgghelskttgnaggriacgviglaki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l9eB (B:)
    mpakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsag
    ahfnpekqdhggpssavrhvgdlgnieaiedsgvtkvsiqdsqislhgpnsiigrtlvvh
    adpddlglgghelskttgnaggriacgviglaki
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l9eC (C:)
    mpakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsag
    ahfnpekqdhggpssavrhvgdlgnieaiedsgvtkvsiqdsqislhgpnsiigrtlvvh
    adpddlglgghelskttgnaggriacgviglaki
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l9eD (D:)
    mpakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsag
    ahfnpekqdhggpssavrhvgdlgnieaiedsgvtkvsiqdsqislhgpnsiigrtlvvh
    adpddlglgghelskttgnaggriacgviglaki