PDB entry 3l72

View 3l72 on RCSB PDB site
Description: Chicken cytochrome BC1 complex with kresoxym-I-dimethyl bound
Class: oxidoreductase
Keywords: CYTOCHROME BC1, MEMBRANE PROTEIN, HEME PROTEIN, RIESKE IRON SULFUR PROTEIN, CYTOCHROME B, CYTOCHROME C1, COMPLEX III, MITOCHONDRIAL PROCESSING PROTEIN, UBIQUINONE, AZOXYSTROBIN OXIDOREDUCTASE, REDOX ENZYME RESPIRATORY CHAIN, ELECTRON TRANSPORT, HEME, INNER MEMBRANE, MEMBRANE, STROBILURINS BINDING, MITOCHONDRION, TRANSMEMBRANE, STIGMATELLIN, IRON, MITOCHONDRIAL INNER MEMBRANE, RESPIRATORY CHAIN, 2FE-2S, IRON-SULFUR, TRANSIT PEPTIDE, Metal-binding, Mitochondrion inner membrane, Transport, Disulfide bond
Deposited on 2009-12-27, released 2010-02-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 3.06 Å
R-factor: 0.264
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72a1, d3l72a2
  • Chain 'B':
    Compound: Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72b1, d3l72b2
  • Chain 'C':
    Compound: cytochrome b
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72c1, d3l72c2
  • Chain 'D':
    Compound: Mitochondrial cytochrome c1, heme protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72d1, d3l72d2
  • Chain 'E':
    Compound: cytochrome b-c1 complex subunit 5, rieske ironsulfur protein, mitochondrial
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase 14 kda protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72f_
  • Chain 'G':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72g_
  • Chain 'H':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase 11 kda protein, complex iii subunit viii
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72h_
  • Chain 'I':
    Compound: Cytochrome b-c1 complex subunit Rieske, mitochondrial
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72j_
  • Chain 'N':
    Compound: Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72n1, d3l72n2
  • Chain 'O':
    Compound: Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72o1, d3l72o2
  • Chain 'P':
    Compound: cytochrome b
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72p1, d3l72p2
  • Chain 'Q':
    Compound: Mitochondrial cytochrome c1, heme protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72q1, d3l72q2
  • Chain 'R':
    Compound: cytochrome b-c1 complex subunit 5, rieske ironsulfur protein, mitochondrial
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase 14 kda protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72s_
  • Chain 'T':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72t_
  • Chain 'U':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase 11 kda protein, complex iii subunit viii
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72u_
  • Chain 'V':
    Compound: Cytochrome b-c1 complex subunit Rieske, mitochondrial
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l72w_
  • Heterogens: HEM, IKR, UQ, CDL, PEE, GOL, HEC, BOG, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l72A (A:)
    aatyaqtlqnipetnvttldnglrvaseessqptctvgvwigagsryeneknngagyfve
    hlafkgtkkrpcaafekevesmgahfngytsreqtafyikalskdmpkvvelladvvqnc
    aleesqiekergvilqelkemdndmtnvtfdylhatafqgtalartvegttenikhltra
    dlasyidthfkaprmvlaaaggishkelvdaarqhfsgvsftykedavpilprcrftgse
    irarddalpvahvalavegpgwadpdnvvlhvanaiigrydrtfgggkhlssrlaalave
    hklchsfqtfntsysdtglfgfhfvadplsiddmmfcaqgewmrlctsttesevkraknh
    lrsamvaqldgttpvcetigshllnygrrisleewdsrisavdarmvrdvcskyiydkcp
    alaavgpieqlldynrirsgmywirf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l72A (A:)
    aatyaqtlqnipetnvttldnglrvaseessqptctvgvwigagsryeneknngagyfve
    hlafkgtkkrpcaafekevesmgahfngytsreqtafyikalskdmpkvvelladvvqnc
    aleesqiekergvilqelkemdndmtnvtfdylhatafqgtalartvegttenikhltra
    dlasyidthfkaprmvlaaaggishkelvdaarqhfsgvsftykedavpilprcrftgse
    irarddalpvahvalavegpgwadpdnvvlhvanaiigrydrtfgggkhlssrlaalave
    hklchsfqtfntsysdtglfgfhfvadplsiddmmfcaqgewmrlctsttesevkraknh
    lrsamvaqldgttpvcetigshllnygrrisleewdsrisavdarmvrdvcskyiydkcp
    alaavgpieqlldynrirsgmywi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l72B (B:)
    slkvapkvavsaaaervklcpgaedleitklpngliiaslenfspasrigvfikagsrye
    ttanlgtahllrlasplttkgassfritrgieavggslsvystrekmtycveclrdhvdt
    vmeyllnvttapefrpwevtdlqpqlkvdkavafqspqvgvlenlhaaayktalanplyc
    pdyrigkitseqlhhfvqnnftsarmalvgigvkhsdlkqvaeqflnirsgagtssakat
    ywggeireqnghslvhaavvtegaavgsaeanafsvlqhvlgagplikrgssvtsklyqg
    vakattqpfdasafnvnysdsglfgfytisqaahageviraamnqlkaaaqggvteedvt
    kaknqlkatylmsvetaqgllneigseallsgthtapsvvaqkidsvtsadvvnaakkfv
    sgkksmaasgdlgstpfldel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l72B (B:)
    pgaedleitklpngliiaslenfspasrigvfikagsryettanlgtahllrlasplttk
    gassfritrgieavggslsvystrekmtycveclrdhvdtvmeyllnvttapefrpwevt
    dlqpqlkvdkavafqspqvgvlenlhaaayktalanplycpdyrigkitseqlhhfvqnn
    ftsarmalvgigvkhsdlkqvaeqflnirsgagtssakatywggeireqnghslvhaavv
    tegaavgsaeanafsvlqhvlgagplikrgssvtsklyqgvakattqpfdasafnvnysd
    sglfgfytisqaahageviraamnqlkaaaqggvteedvtkaknqlkatylmsvetaqgl
    lneigseallsgthtapsvvaqkidsvtsadvvnaakkfvsgkksmaasgdlgstpflde
    l
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l72C (C:)
    mapnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadt
    slafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvil
    lltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrff
    alhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpf
    ltlalfspnllgdpenftpanplvtpphikpewyflfayailrsipnklggvlalaasvl
    ilflipflhkskqrtmtfrplsqtlfwllvanlliltwigsqpvehpfiiigqmaslsyf
    tillilfptigtlenkmlny
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l72D (D:)
    gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae
    akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar
    hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms
    qiakdvctflrwaaepehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrpp
    k
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3l72F (F:)
    aaratvagggrlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermf
    rikraldlslkhrilpkeqwvkyeedkpylepylkevirerlereawnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l72F (F:)
    grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
    lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3l72G (G:)
    gihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllys
    wgtqeferlkrknpadyendq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l72G (G:)
    ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw
    gtqeferlkrknpadyendq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3l72H (H:)
    lrgsgeeeeeelvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdf
    lhardhcvahklfnklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l72H (H:)
    eeeelvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhc
    vahklfnklk
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l72J (J:)
    allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease
    e
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3l72N (N:)
    aatyaqtlqnipetnvttldnglrvaseessqptctvgvwigagsryeneknngagyfve
    hlafkgtkkrpcaafekevesmgahfngytsreqtafyikalskdmpkvvelladvvqnc
    aleesqiekergvilqelkemdndmtnvtfdylhatafqgtalartvegttenikhltra
    dlasyidthfkaprmvlaaaggishkelvdaarqhfsgvsftykedavpilprcrftgse
    irarddalpvahvalavegpgwadpdnvvlhvanaiigrydrtfgggkhlssrlaalave
    hklchsfqtfntsysdtglfgfhfvadplsiddmmfcaqgewmrlctsttesevkraknh
    lrsamvaqldgttpvcetigshllnygrrisleewdsrisavdarmvrdvcskyiydkcp
    alaavgpieqlldynrirsgmywirf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l72N (N:)
    tyaqtlqnipetnvttldnglrvaseessqptctvgvwigagsryeneknngagyfvehl
    afkgtkkrpcaafekevesmgahfngytsreqtafyikalskdmpkvvelladvvqncal
    eesqiekergvilqelkemdndmtnvtfdylhatafqgtalartvegttenikhltradl
    asyidthfkaprmvlaaaggishkelvdaarqhfsgvsftykedavpilprcrftgseir
    arddalpvahvalavegpgwadpdnvvlhvanaiigrydrtfgggkhlssrlaalavehk
    lchsfqtfntsysdtglfgfhfvadplsiddmmfcaqgewmrlctsttesevkraknhlr
    samvaqldgttpvcetigshllnygrrisleewdsrisavdarmvrdvcskyiydkcpal
    aavgpieqlldynrirsgmywi
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3l72O (O:)
    slkvapkvavsaaaervklcpgaedleitklpngliiaslenfspasrigvfikagsrye
    ttanlgtahllrlasplttkgassfritrgieavggslsvystrekmtycveclrdhvdt
    vmeyllnvttapefrpwevtdlqpqlkvdkavafqspqvgvlenlhaaayktalanplyc
    pdyrigkitseqlhhfvqnnftsarmalvgigvkhsdlkqvaeqflnirsgagtssakat
    ywggeireqnghslvhaavvtegaavgsaeanafsvlqhvlgagplikrgssvtsklyqg
    vakattqpfdasafnvnysdsglfgfytisqaahageviraamnqlkaaaqggvteedvt
    kaknqlkatylmsvetaqgllneigseallsgthtapsvvaqkidsvtsadvvnaakkfv
    sgkksmaasgdlgstpfldel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l72O (O:)
    cpgaedleitklpngliiaslenfspasrigvfikagsryettanlgtahllrlaspltt
    kgassfritrgieavggslsvystrekmtycveclrdhvdtvmeyllnvttapefrpwev
    tdlqpqlkvdkavafqspqvgvlenlhaaayktalanplycpdyrigkitseqlhhfvqn
    nftsarmalvgigvkhsdlkqvaeqflnirsgagtssakatywggeireqnghslvhaav
    vtegaavgsaeanafsvlqhvlgagplikrgssvtsklyqgvakattqpfdasafnvnys
    dsglfgfytisqaahageviraamnqlkaaaqggvteedvtkaknqlkatylmsvetaqg
    llneigseallsgthtapsvvaqkidsvtsadvvnaakkfvsgkksmaasgdlgstpfld
    el
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3l72P (P:)
    mapnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadt
    slafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvil
    lltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrff
    alhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpf
    ltlalfspnllgdpenftpanplvtpphikpewyflfayailrsipnklggvlalaasvl
    ilflipflhkskqrtmtfrplsqtlfwllvanlliltwigsqpvehpfiiigqmaslsyf
    tillilfptigtlenkmlny
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l72P (P:)
    apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
    lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
    ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
    lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
    tlalfspnllgdpenftpanplvtpphikpewyflfayailrsipnklggvlalaasvli
    lflipflhkskqrtmtfrplsqtlfwllvanlliltwigsqpvehpfiiigqmaslsyft
    illilfptigtlenkmlny
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l72Q (Q:)
    gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae
    akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar
    hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms
    qiakdvctflrwaaepehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrpp
    k
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3l72S (S:)
    aaratvagggrlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermf
    rikraldlslkhrilpkeqwvkyeedkpylepylkevirerlereawnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l72S (S:)
    grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
    lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3l72T (T:)
    gihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllys
    wgtqeferlkrknpadyendq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l72T (T:)
    ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw
    gtqeferlkrknpadyend
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3l72U (U:)
    lrgsgeeeeeelvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdf
    lhardhcvahklfnklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l72U (U:)
    elvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhcvah
    klfnklk
    

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3l72W (W:)
    allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l72W (W:)
    allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease