PDB entry 3l6y

View 3l6y on RCSB PDB site
Description: Crystal structure of p120 catenin in complex with E-cadherin
Class: cell adhesion
Keywords: p120, catenin, cadherin, E-cadherin, armadillo, ARM, JMD, cell adhesion, complex, cell-cell adhesion, ARVCF, delta-catenin, p0071, Dp120, JAC-1, Cell membrane, Membrane, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Wnt signaling pathway
Deposited on 2009-12-27, released 2010-04-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.233
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catenin delta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTNND1, KIAA0384
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: e-cadherin
    Database cross-references and differences (RAF-indexed):
    • PDB 3L6Y (0-17)
  • Chain 'C':
    Compound: Catenin delta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTNND1, KIAA0384
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l6yc_
  • Chain 'D':
    Compound: e-cadherin
    Database cross-references and differences (RAF-indexed):
    • PDB 3L6Y (0-17)
  • Chain 'E':
    Compound: Catenin delta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTNND1, KIAA0384
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l6ye_
  • Chain 'F':
    Compound: e-cadherin
    Database cross-references and differences (RAF-indexed):
    • PDB 3L6Y (0-17)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3l6yC (C:)
    gspefmigeevpsdqyywaplaqhergslasldslrkggppppnwrqpelpeviamlgfr
    ldavksnaaaylqhlcyrndkvktdvrklkgipvlvglldhpkkevhlgacgalknisfg
    rdqdnkiaikncdgvpalvrllrkardmdltevitgtlwnlsshdsikmeivdhalhalt
    deviiphsgwerepnedckprhiewesvltntagclrnvssersearrklrecdglvdal
    ifivqaeigqkdsdsklvencvcllrnlsyqvhreipqaeryqeaapnvanntgtsparg
    yellfqpevvriyisllkesktpaileasagaiqnlcagrwtygryirsalrqekalsai
    adlltnehervvkaasgalrnlavdarnkeligkhaipnlvknlpggqqnsswnfsedtv
    isilntineviaenleaakklretqgieklvlinksgnrsekevraaalvlqtiwgykel
    rkplekegwkksdfqvnlnnasrsqsshsyddstlplidrnqksdkkpdreeiqmsnmgs
    ntksldnnystpnergdhnrtldrsgdlgdmeplkgttplmqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l6yC (C:)
    pppnwrqpelpeviamlgfrldavksnaaaylqhlcyrndkvktdvrklkgipvlvglld
    hpkkevhlgacgalknisfgrdqdnkiaikncdgvpalvrllrkardmdltevitgtlwn
    lsshdsikmeivdhalhaltdeviiphsgwererhiewesvltntagclrnvssersear
    rklrecdglvdalifivqaeigqkdsdsklvencvcllrnlsyqvhreipqaerspargy
    ellfqpevvriyisllkesktpaileasagaiqnlcagrwtygryirsalrqekalsaia
    dlltnehervvkaasgalrnlavdarnkeligkhaipnlvknlfsedtvisilntinevi
    asekevraaalvlqti
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3l6yE (E:)
    gspefmigeevpsdqyywaplaqhergslasldslrkggppppnwrqpelpeviamlgfr
    ldavksnaaaylqhlcyrndkvktdvrklkgipvlvglldhpkkevhlgacgalknisfg
    rdqdnkiaikncdgvpalvrllrkardmdltevitgtlwnlsshdsikmeivdhalhalt
    deviiphsgwerepnedckprhiewesvltntagclrnvssersearrklrecdglvdal
    ifivqaeigqkdsdsklvencvcllrnlsyqvhreipqaeryqeaapnvanntgtsparg
    yellfqpevvriyisllkesktpaileasagaiqnlcagrwtygryirsalrqekalsai
    adlltnehervvkaasgalrnlavdarnkeligkhaipnlvknlpggqqnsswnfsedtv
    isilntineviaenleaakklretqgieklvlinksgnrsekevraaalvlqtiwgykel
    rkplekegwkksdfqvnlnnasrsqsshsyddstlplidrnqksdkkpdreeiqmsnmgs
    ntksldnnystpnergdhnrtldrsgdlgdmeplkgttplmqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l6yE (E:)
    pppnwrqpelpeviamlgfrldavksnaaaylqhlcyrndkvktdvrklkgipvlvglld
    hpkkevhlgacgalknisfgrdqdnkiaikncdgvpalvrllrkardmdltevitgtlwn
    lsshdsikmeivdhalhaltdeviiphsgwereprhiewesvltntagclrnvssersea
    rrklrecdglvdalifivqaeigqkdsdsklvencvcllrnlsyqvhreipqaeryspar
    gyellfqpevvriyisllkesktpaileasagaiqnlcagrwtygryirsalrqekalsa
    iadlltnehervvkaasgalrnlavdarnkeligkhaipnlvknlpnfsedtvisilnti
    neviaegieklvlinksrsekevraaalvlqtiwgyk
    

  • Chain 'F':
    No sequence available.