PDB entry 3l6x

View 3l6x on RCSB PDB site
Description: Crystal structure of p120 catenin in complex with E-cadherin
Class: cell adhesion
Keywords: p120, catenin, cadherin, E-cadherin, armadillo, ARM, JMD, cell adhesion, complex, cell-cell adhesion, ARVCF, delta-catenin, p0071, Dp120, JAC-1, Cell membrane, Membrane, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Wnt signaling pathway
Deposited on 2009-12-27, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catenin delta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTNND1, KIAA0384
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l6xa_
  • Chain 'B':
    Compound: e-cadherin
    Database cross-references and differences (RAF-indexed):
    • PDB 3L6X (0-17)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l6xA (A:)
    gspefmigeevpsdqyywaplaqhergslasldslrkggppppnwrqpelpeviamlgfr
    ldavksnaaaylqhlcyrndkvktdvrklkgipvlvglldhpkkevhlgacgalknisfg
    rdqdnkiaikncdgvpalvrllrkardmdltevitgtlwnlsshdsikmeivdhalhalt
    deviiphsgwerepnedckprhiewesvltntagclrnvssersearrklrecdglvdal
    ifivqaeigqkdsdsklvencvcllrnlsyqvhreipqaeryqeaapnvanntgtsparg
    yellfqpevvriyisllkesktpaileasagaiqnlcagrwtygryirsalrqekalsai
    adlltnehervvkaasgalrnlavdarnkeligkhaipnlvknlpggqqnsswnfsedtv
    isilntineviaenleaakklretqgieklvlinksgnrsekevraaalvlqtiwgykel
    rkplekegwkksdfqvnlnnasrsqsshsyddstlplidrnqksdkkpdreeiqmsnmgs
    ntksldnnystpnergdhnrtldrsgdlgdmeplkgttplmqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l6xA (A:)
    ppppnwrqpelpeviamlgfrldavksnaaaylqhlcyrndkvktdvrklkgipvlvgll
    dhpkkevhlgacgalknisfgrdqdnkiaikncdgvpalvrllrkardmdltevitgtlw
    nlsshdsikmeivdhalhaltdeviiphsgwehiewesvltntagclrnvssersearrk
    lrecdglvdalifivqaeigqkdsdsklvencvcllrnlsyqvhreipqaerspargyel
    lfqpevvriyisllkesktpaileasagaiqnlcagrwtygryirsalrqekalsaiadl
    ltnehervvkaasgalrnlavdarnkeligkhaipnlvknlpggqqnsswnfsedtvisi
    lntineviaenleaakklretqgieklvlinksgnrsekevraaalvlqtiwgykelrkp
    lekegwkksdfqvn
    

  • Chain 'B':
    No sequence available.