PDB entry 3l5y

View 3l5y on RCSB PDB site
Description: Crystal structure of the complex between IL-13 and M1295 FAB
Class: immune system
Keywords: immunoglobulin fold, alpha-helical bundle, Cytokine, Disulfide bond, Glycoprotein, Secreted, MONOCLONAL ANTIBODY, IMMUNE SYSTEM
Deposited on 2009-12-22, released 2010-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-13
    Species: Homo sapiens [TaxId:9606]
    Gene: IL13, NC30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5ya_
  • Chain 'H':
    Compound: m1295 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L5Y (0-End)
  • Chain 'L':
    Compound: m1295 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L5Y (0-212)
    Domains in SCOPe 2.07: d3l5yl3, d3l5yl4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l5yA (A:)
    mgpvppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsai
    ektqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l5yA (A:)
    pstalrelieelvnitqplcngsmvwmycaaleslinvsgcsaiektqrmlsgfcphkvs
    atkievaqfvkdlllhlkklfregr
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5yL (L:)
    eivltqspatlslspgeratlscrasksiskylawyqqkpgqaprlliysgstlqsgipa
    rfsgsgsgtdftltisslepedfavyycqqhdypytfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec