PDB entry 3l5w

View 3l5w on RCSB PDB site
Description: Crystal structure of the complex between IL-13 and C836 FAB
Class: immune system
Keywords: immunoglobulin fold, alpha-helical bundle, Cytokine, Disulfide bond, Glycoprotein, Polymorphism, Secreted, MONOCLONAL ANTIBODY, IMMUNE SYSTEM
Deposited on 2009-12-22, released 2010-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c836 light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L5W (0-End)
    Domains in SCOPe 2.07: d3l5wa1, d3l5wa2
  • Chain 'B':
    Compound: c836 heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L5W (0-End)
  • Chain 'H':
    Compound: c836 heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L5W (0-End)
  • Chain 'I':
    Compound: interleukin-13
    Species: Homo sapiens [TaxId:9606]
    Gene: IL13, NC30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5wi_
  • Chain 'J':
    Compound: interleukin-13
    Species: Homo sapiens [TaxId:9606]
    Gene: IL13, NC30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5wj_
  • Chain 'L':
    Compound: c836 light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L5W (0-End)
    Domains in SCOPe 2.07: d3l5wl1, d3l5wl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l5wA (A:)
    dvqitqspsylaaspgetitlncrasksiskylawyqekpgktnklliysgstlqsgips
    rfsgsgsgtdftltisslepedfamyfcqqhneypytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l5wA (A:)
    dvqitqspsylaaspgetitlncrasksiskylawyqekpgktnklliysgstlqsgips
    rfsgsgsgtdftltisslepedfamyfcqqhneypytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3l5wI (I:)
    mgpvppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsai
    ektqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l5wI (I:)
    stalrelieelvnitqaplcngsmvwsinltagmycaaleslinvsgcsaiektqrmlsg
    fcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfreg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3l5wJ (J:)
    mgpvppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsai
    ektqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l5wJ (J:)
    stalrelieelvnitqlcngsmvwsinltmycaaleslinvsgcsaiektqrmlsgfcph
    kvsakievaqfvkdlllhlkklfreg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3l5wL (L:)
    dvqitqspsylaaspgetitlncrasksiskylawyqekpgktnklliysgstlqsgips
    rfsgsgsgtdftltisslepedfamyfcqqhneypytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l5wL (L:)
    dvqitqspsylaaspgetitlncrasksiskylawyqekpgktnklliysgstlqsgips
    rfsgsgsgtdftltisslepedfamyfcqqhneypytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge