PDB entry 3l5q

View 3l5q on RCSB PDB site
Description: Proteasome Activator Complex
Class: hydrolase
Keywords: 20S Proteasome BLM10, Hydrolase, Nucleus, Phosphoprotein, Protease, Proteasome, Threonine protease, Isopeptide bond, Zymogen
Deposited on 2009-12-22, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.196
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome component C11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5q1_
  • Chain '2':
    Compound: Proteasome component PRE2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30656 (0-211)
      • conflict (32)
    Domains in SCOPe 2.07: d3l5q2_
  • Chain '3':
    Compound: Proteasome component C5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5q3_
  • Chain '4':
    Compound: Proteasome component PRE4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5q4_
  • Chain '5':
    Compound: Proteasome activator BLM10
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43583 (0-798)
      • conflict (60)
      • conflict (563)
      • conflict (645)
  • Chain '6':
    Compound: Proteasome activator BLM10
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43583 (0-996)
      • conflict (21)
      • conflict (24)
      • conflict (938)
      • conflict (954)
  • Chain '7':
    Compound: Proteasome activator BLM10
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43583 (0-798)
      • conflict (60)
      • conflict (563)
      • conflict (645)
  • Chain '8':
    Compound: Proteasome activator BLM10
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43583 (0-996)
      • conflict (21)
      • conflict (24)
      • conflict (938)
      • conflict (954)
  • Chain 'A':
    Compound: Proteasome component C7-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qa_
  • Chain 'B':
    Compound: Proteasome component PRE3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38624 (1-195)
      • expression tag (0)
    Domains in SCOPe 2.07: d3l5qb1, d3l5qb2
  • Chain 'C':
    Compound: Proteasome component C7-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qc_
  • Chain 'D':
    Compound: Proteasome component PRE3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38624 (1-195)
      • expression tag (0)
    Domains in SCOPe 2.07: d3l5qd1, d3l5qd2
  • Chain 'E':
    Compound: Proteasome activator BLM10
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Proteasome activator BLM10
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Proteasome component Y7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qg_
  • Chain 'H':
    Compound: Proteasome component Y13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qh_
  • Chain 'I':
    Compound: Proteasome component PRE6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qi_
  • Chain 'J':
    Compound: Proteasome component PUP2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Proteasome component PRE5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qk_
  • Chain 'L':
    Compound: Proteasome component C1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5ql_
  • Chain 'M':
    Compound: Proteasome component PUP1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qm_
  • Chain 'N':
    Compound: Proteasome component PUP3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qn_
  • Chain 'O':
    Compound: Proteasome component C11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qo_
  • Chain 'P':
    Compound: Proteasome component PRE2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30656 (0-211)
      • conflict (32)
    Domains in SCOPe 2.07: d3l5qp_
  • Chain 'Q':
    Compound: Proteasome component C5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qq_
  • Chain 'R':
    Compound: Proteasome component PRE4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qr_
  • Chain 'S':
    Compound: Proteasome component Y7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qs_
  • Chain 'T':
    Compound: Proteasome component Y13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qt_
  • Chain 'U':
    Compound: Proteasome component PRE6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qu_
  • Chain 'V':
    Compound: Proteasome component PUP2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Proteasome component PRE5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qw_
  • Chain 'X':
    Compound: Proteasome component C1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qx_
  • Chain 'Y':
    Compound: Proteasome component PUP1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qy_
  • Chain 'Z':
    Compound: Proteasome component PUP3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l5qz_

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5q1 (1:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5q2 (2:)
    tttlafrfqggiivavdsratagnwvasqtvkrvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5q3 (3:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5q4 (4:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain '5':
    No sequence available.

  • Chain '6':
    No sequence available.

  • Chain '7':
    No sequence available.

  • Chain '8':
    No sequence available.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qA (A:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qB (B:)
    asimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qC (C:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qD (D:)
    asimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qG (G:)
    qidyaltavkqgvtslgikatngvviatekksssplamsetlskvslltpdigavysgmg
    pdyrvlvdksrkvahtsykriygeypptkllvsevakimqeatqsggvrpfgvslliagh
    defngfslyqvdpsgsyfpwkataigkgsvaaktflekrwndeleledaihialltlkes
    vegefngdtielaiigdenpdllgytgiptdkgprfrkltsqeindrleal
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qH (H:)
    spegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtsteklyklndki
    avavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqhgglrpfgv
    sfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmkvddaiela
    lktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgit
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qI (I:)
    ifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritpskvskidshvvlsfs
    glnadsriliekarveaqshrltledpvtveyltryvagvqqrytqsggvrpfgvstlia
    gfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrkeppatveecvkltv
    rsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqeq
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qK (K:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qL (L:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qM (M:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qN (N:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qO (O:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qP (P:)
    tttlafrfqggiivavdsratagnwvasqtvkrvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qQ (Q:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qR (R:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qS (S:)
    qidyaltavkqgvtslgikatngvviatekksssplamsetlskvslltpdigavysgmg
    pdyrvlvdksrkvahtsykriygeypptkllvsevakimqeatqsggvrpfgvslliagh
    defngfslyqvdpsgsyfpwkataigkgsvaaktflekrwndeleledaihialltlkes
    vegefngdtielaiigdenpdllgytgiptdkgprfrkltsqeindrleal
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qT (T:)
    spegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtsteklyklndki
    avavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqhgglrpfgv
    sfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmkvddaiela
    lktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgit
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qU (U:)
    ifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritpskvskidshvvlsfs
    glnadsriliekarveaqshrltledpvtveyltryvagvqqrytqsggvrpfgvstlia
    gfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrkeppatveecvkltv
    rsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqeq
    

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qW (W:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qX (X:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qY (Y:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l5qZ (Z:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd