PDB entry 3l55

View 3l55 on RCSB PDB site
Description: Crystal structure of a putative beta-1,4-endoglucanase / cellulase from Prevotella bryantii
Class: Structural Genomics, Unknown function
Keywords: putative beta-1,4-endoglucanase, cellulase, glycosyl hydrolase family 5, MIXED ALPHA-BETA, TIM BARREL, STRUCTURAL GENOMICS, PSI-2, PROTEIN STRUCTURE INITIATIVE, MIDWEST CENTER FOR STRUCTURAL GENOMICS, MCSG, unknown function, Ontario Centre for Structural Proteomics, OCSP
Deposited on 2009-12-21, released 2010-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.192
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-1,4-endoglucanase/cellulase
    Species: Prevotella bryantii [TaxId:77095]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l55a_
  • Chain 'B':
    Compound: B-1,4-endoglucanase/cellulase
    Species: Prevotella bryantii [TaxId:77095]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l55b_
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l55A (A:)
    minqnatymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtf
    lmqngfnavripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsg
    awikadtdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgye
    alnnyaqdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsy
    dpwnffntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaeki
    klaadqaadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeaynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l55A (A:)
    ymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqngfn
    avripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawikadt
    dvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgyealnnyaq
    dfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsydpwnffn
    tkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaekiklaadqa
    admvklakdhhsatfywmsifdgsdriqpqwslptvveamqeayn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l55B (B:)
    minqnatymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtf
    lmqngfnavripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsg
    awikadtdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgye
    alnnyaqdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsy
    dpwnffntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaeki
    klaadqaadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeaynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l55B (B:)
    tymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqngf
    navripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawikad
    tdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgyealnnya
    qdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsydpwnff
    ntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaekiklaadq
    aadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeayn