PDB entry 3l43

View 3l43 on RCSB PDB site
Description: Crystal structure of the dynamin 3 GTPase domain bound with GDP
Class: hydrolase
Keywords: structural genomics consortium, sgc, Cytoskeleton, Endocytosis, GTP-binding, Hydrolase, Microtubule, Motor protein, Nucleotide-binding, Phosphoprotein
Deposited on 2009-12-18, released 2010-01-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.23
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynamin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: DNM3, KIAA0820
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQ16
      • engineered (86)
    Domains in SCOPe 2.05: d3l43a_
  • Chain 'B':
    Compound: Dynamin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: DNM3, KIAA0820
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQ16
      • engineered (86)
    Domains in SCOPe 2.05: d3l43b_
  • Chain 'C':
    Compound: Dynamin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: DNM3, KIAA0820
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQ16
      • engineered (86)
    Domains in SCOPe 2.05: d3l43c_
  • Chain 'D':
    Compound: Dynamin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: DNM3, KIAA0820
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQ16
      • engineered (86)
    Domains in SCOPe 2.05: d3l43d_
  • Heterogens: GDP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l43A (A:)
    mhhhhhhssgrenlyfqgmeeliplvnrlqdafsalgqscllelpqiavvggqsagkssv
    lenfvgrdflprgsgivtrrplvlqlitskaeyaeflhckgkkftdfdevrleieaetdr
    vtgmnkgissipinlrvysphvlnltlidlpgitkvpvgdqppdieyqiremimqfitre
    nclilavtpantdlansdalklakevdpqglrtigvitkldlmdegtdardvlenkllpl
    rrgyvgvvnrsqkdidgkkdikaamlaerkfflshpayrhiadrmgtphlqkvlnqqltn
    hirdtlpnfrnklqgqlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l43A (A:)
    qiavvggqsagkssvlenfvgrdflprvtrrplvlqlitskaeyaeflhckgkkftdfde
    vrleieaetdissipinlrvysphvlnltlidlpgitkvpvgdqppdieyqiremimqfi
    trenclilavtpantdlansdalklakevdpqglrtigvitkldlmdegtdardvlenkl
    lplrrgyvgvvnrsqkdidgkkdikaamlaerkfflshpayrhiadrmgtphlqkvlnqq
    lt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l43B (B:)
    mhhhhhhssgrenlyfqgmeeliplvnrlqdafsalgqscllelpqiavvggqsagkssv
    lenfvgrdflprgsgivtrrplvlqlitskaeyaeflhckgkkftdfdevrleieaetdr
    vtgmnkgissipinlrvysphvlnltlidlpgitkvpvgdqppdieyqiremimqfitre
    nclilavtpantdlansdalklakevdpqglrtigvitkldlmdegtdardvlenkllpl
    rrgyvgvvnrsqkdidgkkdikaamlaerkfflshpayrhiadrmgtphlqkvlnqqltn
    hirdtlpnfrnklqgqlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l43B (B:)
    pqiavvggqsagkssvlenfvgrdflprvtrrplvlqlitskaeyaeflhckgkkftdfd
    evrleieaetdrvtissipinlrvysphvlnltlidlpgitkvpvgdqppdieyqiremi
    mqfitrenclilavtpantdlansdalklakevdpqglrtigvitkldlmdegtdardvl
    enkllplrrgyvgvvnrsqkdidgkkdikaamlaerkfflshpayrhiadrmgtphlqkv
    lnqqlt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3l43C (C:)
    mhhhhhhssgrenlyfqgmeeliplvnrlqdafsalgqscllelpqiavvggqsagkssv
    lenfvgrdflprgsgivtrrplvlqlitskaeyaeflhckgkkftdfdevrleieaetdr
    vtgmnkgissipinlrvysphvlnltlidlpgitkvpvgdqppdieyqiremimqfitre
    nclilavtpantdlansdalklakevdpqglrtigvitkldlmdegtdardvlenkllpl
    rrgyvgvvnrsqkdidgkkdikaamlaerkfflshpayrhiadrmgtphlqkvlnqqltn
    hirdtlpnfrnklqgqlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l43C (C:)
    qiavvggqsagkssvlenfvgrdflprtrrplvlqlitskaeyaeflhckgkkftdfdev
    rleieaetdissipinlrvysphvlnltlidlpgitkvpvgdqppdieyqiremimqfit
    renclilavtpantdlansdalklakevdpqglrtigvitkldlmdegtdardvlenkll
    plrrgyvgvvnrsqkdidgkkdikaamlaerkfflshpayrhiadrmgtphlqkvlnq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3l43D (D:)
    mhhhhhhssgrenlyfqgmeeliplvnrlqdafsalgqscllelpqiavvggqsagkssv
    lenfvgrdflprgsgivtrrplvlqlitskaeyaeflhckgkkftdfdevrleieaetdr
    vtgmnkgissipinlrvysphvlnltlidlpgitkvpvgdqppdieyqiremimqfitre
    nclilavtpantdlansdalklakevdpqglrtigvitkldlmdegtdardvlenkllpl
    rrgyvgvvnrsqkdidgkkdikaamlaerkfflshpayrhiadrmgtphlqkvlnqqltn
    hirdtlpnfrnklqgqlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l43D (D:)
    qiavvggqsagkssvlenfvgrdflprtrrplvlqlitskaeyaeflhckgkkftdfdev
    rleieaetdissipinlrvysphvlnltlidlpgitkvpvgdqppdieyqiremimqfit
    renclilavtpantdlansdalklakevdpqglrtigvitkldlmdegtdardvlenkll
    plrrgyvgvvnrsqkdidgkkdikaamlaerkfflshpayrhiadrmgtphlqkvlnqq