PDB entry 3l3h

View 3l3h on RCSB PDB site
Description: X-ray crystal structure of the F6A mutant of influenza A acid polymerase epitope PA224 bound to murine H2-Db MHC
Class: immune system
Keywords: Animals Antigens, Viral Epitopes, T-Lymphocyte Histocompatibility Antigens, Mice Antigen, T-Cell, T-Lymphocytes, Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Immunoglobulin domain, Secreted, IMMUNE SYSTEM
Deposited on 2009-12-17, released 2010-03-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.227
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: H-2 class I histocompatibility antigen, D-B alpha chain
  Species: Mus musculus [TaxId:10090]
  Gene: H2-D1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01899 (0-274)
• Chain 'B':
  Compound: Beta-2-microglobulin
  Species: Mus musculus [TaxId:10090]
  Gene: B2M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.04: d3l3hb_
• Chain 'C':
  Compound: 10-mer peptide from Polymerase acidic protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q17TI0 (0-9)
    • engineered (5)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3l3hB (B:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'C':
  No sequence available.