PDB entry 3l3c

View 3l3c on RCSB PDB site
Description: Crystal structure of the Bacillus anthracis glmS ribozyme bound to Glc6P
Class: RNA binding protein/RNA
Keywords: catalytic RNA, RNA binding protein-RNA complex
Deposited on 2009-12-16, released 2009-12-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.265
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Gene: SNRPA
  Domains in SCOPe 2.04: d3l3ca_
• Chain 'B':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Gene: SNRPA
  Domains in SCOPe 2.04: d3l3cb_
• Chain 'C':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Gene: SNRPA
  Domains in SCOPe 2.04: d3l3cc_
• Chain 'D':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Gene: SNRPA
  Domains in SCOPe 2.04: d3l3cd_
• Chain 'E':
  Compound: RNA (5'-r(*ap*(a2m)*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
  Species: synthetic, synthetic
  
• Chain 'F':
  Compound: RNA (5'-r(*ap*(a2m)*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
  Species: synthetic, synthetic
  
• Chain 'G':
  Compound: RNA (5'-r(*ap*(a2m)*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
  Species: synthetic, synthetic
  
• Chain 'H':
  Compound: RNA (5'-r(*ap*(a2m)*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
  Species: synthetic, synthetic
  
• Chain 'P':
  Compound: glms ribozyme
  Species: synthetic, synthetic
  
• Chain 'Q':
  Compound: glms ribozyme
  Species: synthetic, synthetic
  
• Chain 'R':
  Compound: glms ribozyme
  Species: synthetic, synthetic
  
• Chain 'S':
  Compound: glms ribozyme
  Species: synthetic, synthetic
  
• Heterogens: MG, G6P, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3l3cA (A:)
  rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
  nalrsmqgfpfydkpmriqyaktdsdiiak
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3l3cB (B:)
  rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
  nalrsmqgfpfydkpmriqyaktdsdiiak
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3l3cC (C:)
  rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
  nalrsmqgfpfydkpmriqyaktdsdiiak
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3l3cD (D:)
  rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
  nalrsmqgfpfydkpmriqyaktdsdiiak
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.