PDB entry 3l30

View 3l30 on RCSB PDB site
Description: Crystal structure of porcine pancreatic phospholipase A2 complexed with dihydroxyberberine
Class: hydrolase
Keywords: Phospholipase A2, dihydroxyberberine, Disulfide bond, Hydrolase, Lipid degradation, Lipoprotein, Metal-binding, Palmitate, Pyrrolidone carboxylic acid, Secreted
Deposited on 2009-12-16, released 2010-01-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.167
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3l30a_
  • Heterogens: CA, CL, DBW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l30A (A:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc