PDB entry 3l2c

View 3l2c on RCSB PDB site
Description: Crystal Structure of the DNA Binding Domain of FOXO4 Bound to DNA
Class: transcription/DNA
Keywords: forkhead, forkhead box, winged helix, TRANSCRIPTION-DNA COMPLEX
Deposited on 2009-12-15, released 2009-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Forkhead box protein O4
  Species: Homo sapiens [TaxId:9606]
  Gene: AFX, AFX1, FOXO4, MLLT7
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98177
  Domains in SCOPe 2.08: d3l2ca_
• Chain 'B':
  Compound: FOXO consensus binding sequence, plus strand
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: FOXO consensus binding sequence, minus strand
  Species: synthetic, synthetic
  
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3l2cA (A:)
  gshmledpgavtgprkggsrrnawgnqsyaelisqaiesapekrltlaqiyewmvrtvpy
  fkdkgdsnssagwknsirhnlslhskfikvhneatgksswwmlnpeggks
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3l2cA (A:)
  rrnawgnqsyaelisqaiesapekrltlaqiyewmvrtvpyfkdkgdsnssagwknsirh
  nlslhskfikvhneatgksswwmln
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.