PDB entry 3l1y

View 3l1y on RCSB PDB site
Description: Crystal structure of human UBC4 E2 conjugating enzyme
Class: ligase
Keywords: E2 CONJUGATING ENZYME, UBIQUITIN LIGASE, Ubl conjugation pathway, LIGASE
Deposited on 2009-12-14, released 2010-05-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2D2, UBC4, UBCH5B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62837 (10-156)
      • expression tag (5-9)
      • see remark 999 (137)
    Domains in SCOPe 2.04: d3l1ya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l1yA (A:)
    mhhhhhhmnsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvf
    fltihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsll
    cdpnpddplvpeiariyqtdrekynriarewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l1yA (A:)
    hhmnsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltih
    fptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnp
    ddplvpeiariyqtdrekynriarewtqkyam