PDB entry 3l1o

View 3l1o on RCSB PDB site
Description: Crystal structure of monoclonal antibody MN423 Fab fragment with free combining site, crystallized in the presence of zinc
Class: immune system
Keywords: monoclonal antibody, IMMUNE SYSTEM
Deposited on 2009-12-14, released 2010-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.162
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: monoclonal antibody fab fragment mn423 h chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L1O (0-226)
  • Chain 'L':
    Compound: monoclonal antibody fab fragment mn423 l chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3L1O (0-213)
    Domains in SCOPe 2.06: d3l1ol1, d3l1ol2
  • Heterogens: NA, ZN, IMD, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l1oL (L:)
    dvqitqspsylaaspgetitincrasksirkflawyrekpgktnklliysgstlqsgtps
    rfsgsgsgtdftltisrlepedfamyycqqhndypltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec