PDB entry 3l1h

View 3l1h on RCSB PDB site
Description: Crystal structure of EstE5, was soaked by FeCl3
Class: hydrolase
Keywords: HSL, EstE5, esterase, lipase, HYDROLASE
Deposited on 2009-12-11, released 2010-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Esterase/lipase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l1ha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l1hA (A:)
    masmtggqqmgrgmagpeivklkkilrekavppgtevpldvmrkgmekvafkaaddiqve
    qvtvagcaaewvrapgcqagkailylhgggyvmgsinthrsmvgeisrasqaaallldyr
    lapehpfpaavedgvaayrwlldqgfkpqhlsisgdsaggglvlavlvsardqglpmpas
    aipispwadmtctndsfktraeadpmvapgginkmaarylngadakhpyaspnfanlkgl
    ppllihvgrdevllddsikldakakadgvkstleiwddmihvwhafhpmlpegkqaivrv
    gefmreqwaalaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l1hA (A:)
    magpeivklkkilrekavppgtevpldvmrkgmekvafkaaddiqveqvtvagcaaewvr
    apgcqagkailylhgggyvmgsinthrsmvgeisrasqaaallldyrlapehpfpaaved
    gvaayrwlldqgfkpqhlsisgdsaggglvlavlvsardqglpmpasaipispwadmtct
    ndsfktraeadpmgginkmaarylngadakhpyaspnfanlkglppllihvgrdevlldd
    sikldakakadgvkstleiwddmihvwhafhpmlpegkqaivrvgefmreqwaa