PDB entry 3l0o

View 3l0o on RCSB PDB site
Description: Structure of RNA-free Rho transcription termination factor from Thermotoga maritima
Class: hydrolase
Keywords: helicase, Rho factor, RNA capture mechanism, transcription termination, ATP-binding, Hydrolase, Nucleotide-binding, RNA-binding, Transcription, Transcription regulation
Deposited on 2009-12-10, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.269
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription termination factor rho
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: transcription termination factor rho
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l0ob1, d3l0ob2
  • Heterogens: IUM, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l0oB (B:)
    mseeqktisiselesmnikqlyeiakslgiprytsmrkrdlifailkaqtestgyffgeg
    vleihpegfgflrriednllpsnddiyispsqirkfnlntgdiisgvirkpkegekyfam
    ikieainyrpveavndrvnfdnltpdyprerfiletdpkiystrlidlfapigkgqrgmi
    vappkagkttilkeiangiaenhpdtiriilliderpeevtdirestnaiviaapfdmpp
    dkqvkvaeltlemakrlvefnydvvilldsltrlarvynivvppsgklltggvdpaalyk
    pkrffgaarntreggsltiiatalvetgskmdevifeefkgtgnmelvlsrqlankrifp
    ainlllsgtrreellldeetlkkvwllrrmlsamteeegltlilnklsetssneeflkli
    dkekary
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l0oB (B:)
    gegvleihpegfgflrriednllpsnddiyispsqirkfnlntgdiisgviamikieain
    yrprvnfdnltpdyprerfiletdpkiystrlidlfapigkgqrgmivappkagkttilk
    eiangiaenhpdtiriilliderpeevtdirestnaiviaapfdmppdkqvkvaeltlem
    akrlvefnydvvilldsltrlarvynivvppsgklltggvdpaalykpkrffgaarntre
    ggsltiiatalvetgskmdevifeefkgtgnmelvlsrqlankrifpainlllsgtrree
    llldeetlkkvwllrrmlsamteeegltlilnklsetssneeflkli