PDB entry 3l0l

View 3l0l on RCSB PDB site
Description: Crystal structure of orphan nuclear receptor RORgamma in complex with natural ligand
Class: transcription
Keywords: nuclear receptor, RORgamma, DNA-binding, Metal-binding, Nucleus, Receptor, Transcription, Transcription regulation, Zinc-finger, Activator, Phosphoprotein
Deposited on 2009-12-10, released 2010-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l0la_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l0lb_
  • Chain 'C':
    Compound: scr2-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA2, TIF2
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: scr2-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA2, TIF2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HC3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l0lA (A:)
    peapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwer
    cahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffe
    gkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkv
    eqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafp
    plykelfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l0lA (A:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpp
    lykelfs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l0lB (B:)
    peapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwer
    cahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffe
    gkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkv
    eqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafp
    plykelfs
    

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    No sequence available.