PDB entry 3l0j

View 3l0j on RCSB PDB site
Description: Crystal structure of orphan nuclear receptor RORgamma in complex with natural ligand
Class: transcription
Keywords: ROR gamma, nuclear receptors, Alternative splicing, DNA-binding, Metal-binding, Nucleus, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger, Acetylation, Activator, Phosphoprotein, Polymorphism
Deposited on 2009-12-10, released 2010-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3l0ja_
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA2, TIF2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HC9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3l0jA (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
    lfs
    

  • Chain 'C':
    No sequence available.