PDB entry 3l0i

View 3l0i on RCSB PDB site
Description: Complex structure of SidM/DrrA with the wild type Rab1
Class: protein binding/protein transport
Keywords: GEF-GDF-Rab complex, GTP-binding, guanine-nucleotide exchange factor, GDI-Displacement factor, Type IV effector protein from legionella, PROTEIN BINDING-PROTEIN TRANSPORT complex
Deposited on 2009-12-10, released 2009-12-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.23
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: drra
    Species: Legionella pneumophila [TaxId:446]
    Gene: sidM
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ras-related protein Rab-1A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3l0ib_
  • Chain 'C':
    Compound: drra
    Species: Legionella pneumophila [TaxId:446]
    Gene: sidM
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ras-related protein Rab-1A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3l0id_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l0iB (B:)
    mgsshhhhhhssgenlyfqgrpmssmnpeydylfkllligdsgvgksclllrfaddtyte
    syistigvdfkirtieldgktiklqiwdtagqerfrtitssyyrgahgiivvydvtdqes
    fnnvkqwlqeidryasenvnkllvgnkcdlttkkvvdyttakefadslgipfletsakna
    tnveqsfmtmaaeikkrmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l0iB (B:)
    smpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklq
    iwdtagqerfrtitssrgahgiivvyvtdqesfnnvkqwlqeidryaenvnkllvnkcdl
    tkvvdyttkefadslgipfletsatnveqsfmtmaaeikkrm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3l0iD (D:)
    mgsshhhhhhssgenlyfqgrpmssmnpeydylfkllligdsgvgksclllrfaddtyte
    syistigvdfkirtieldgktiklqiwdtagqerfrtitssyyrgahgiivvydvtdqes
    fnnvkqwlqeidryasenvnkllvgnkcdlttkkvvdyttakefadslgipfletsakna
    tnveqsfmtmaaeikkrmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l0iD (D:)
    smnpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktikl
    qiwdtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllv
    gnkcdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm