PDB entry 3l03

View 3l03 on RCSB PDB site
Description: Crystal Structure of human Estrogen Receptor alpha Ligand-Binding Domain in complex with a Glucocorticoid Receptor Interacting Protein 1 Nr Box II peptide and Estetrol (Estra-1,3,5(10)-triene-3,15 alpha,16alpha,17beta-tetrol)
Class: transcription
Keywords: estrogen receptor, LBD, GRIP peptide, estetrol, DNA-binding, Glycoprotein, Lipid-binding, Metal-binding, Nucleus, Phosphoprotein, Receptor, Steroid-binding, Transcription, Transcription regulation, Zinc-finger, Activator
Deposited on 2009-12-09, released 2010-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR, ESR1, ESR1_HUMAN, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (239)
    Domains in SCOPe 2.06: d3l03a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR, ESR1, ESR1_HUMAN, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (Start-252)
      • engineered (239)
    Domains in SCOPe 2.06: d3l03b_
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: nuclear receptor coactivator 2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, GOL, 4OH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l03A (A:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpls
    dlllemldahrlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l03A (A:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytleekdhihrvldkitdtlihlmak
    agltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l03B (B:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpls
    dlllemldahrlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l03B (B:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsksleekdhihrvldkitdtli
    hlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldah
    rlh
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.