PDB entry 3kyp

View 3kyp on RCSB PDB site
Description: crystal structure of nucleosome assembly protein s (pfnaps) from plasmodium falciparum
Deposited on 2009-12-07, released 2010-06-02
Made obsolete by 5x7v on 2017-03-15

The last revision was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3kypA (A:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records):
    >3kypA (A:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdkvv
    ectrikwkegknpiakwsifewfttdelqdkpdvgelirreiwhnplsyyl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3kypB (B:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records):
    >3kypB (B:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnykitfifgekakefmepltlvkhvtfekvvectrik
    wkegknpiakwsifewfttdelqdkpdvgelirreiwhnplsyyl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3kypC (C:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records):
    >3kypC (C:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdngsykitfifgekakefmepltlvkhvtqekvve
    ctrikwkegknpiaifewfttdelqdkpdvgelirreiwhnplsyyl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3kypD (D:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records):
    >3kypD (D:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvfdnkvv
    ectrikwkegknpiaifewfttdelqdkpdvgelirreiwhnplsyyl
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3kypE (E:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records):
    >3kypE (E:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtkvvec
    trikwkegknpiawsifewfttdelqdkpdvgelirreiwhnplsyyl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3kypF (F:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records):
    >3kypF (F:)
    mqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhpa
    lsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvkvvectr
    ikwkegknpiakwsifewfttdelqdkpdvgelirreiwhnplsyyl