PDB entry 3kym

View 3kym on RCSB PDB site
Description: Crystal structure of Li33 IgG2 di-Fab
Class: immune system
Keywords: IgG2 monoclonal anti-Lingo, IMMUNE SYSTEM
Deposited on 2009-12-06, released 2010-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.267
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Light Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
    Domains in SCOPe 2.07: d3kyma1, d3kyma2
  • Chain 'B':
    Compound: Heavy Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
  • Chain 'C':
    Compound: Light Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
    Domains in SCOPe 2.07: d3kymc1, d3kymc2
  • Chain 'D':
    Compound: Heavy Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
  • Chain 'E':
    Compound: Light Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
    Domains in SCOPe 2.07: d3kyme1, d3kyme2
  • Chain 'F':
    Compound: Heavy Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
  • Chain 'G':
    Compound: Light Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
    Domains in SCOPe 2.07: d3kymg1, d3kymg2
  • Chain 'H':
    Compound: Heavy Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
  • Chain 'I':
    Compound: Light Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
    Domains in SCOPe 2.07: d3kymi1, d3kymi2
  • Chain 'J':
    Compound: Heavy Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
  • Chain 'K':
    Compound: Light Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
    Domains in SCOPe 2.07: d3kymk1, d3kymk2
  • Chain 'L':
    Compound: Heavy Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
  • Chain 'M':
    Compound: Light Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
    Domains in SCOPe 2.07: d3kymm1, d3kymm2
  • Chain 'N':
    Compound: Heavy Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
  • Chain 'O':
    Compound: Light Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)
    Domains in SCOPe 2.07: d3kymo1, d3kymo2
  • Chain 'P':
    Compound: Heavy Chain Li33 IgG2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KYM (0-End)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kymA (A:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kymA (A:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kymC (C:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kymC (C:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3kymE (E:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kymE (E:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3kymG (G:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kymG (G:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3kymI (I:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kymI (I:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3kymK (K:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kymK (K:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfpsde
    qlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk
    adyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3kymM (M:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kymM (M:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtks
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3kymO (O:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kymO (O:)
    diqmtqspgtlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgteftltisslqsedfavyycqqydkwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'P':
    No sequence available.