PDB entry 3kyj

View 3kyj on RCSB PDB site
Description: Crystal structure of the P1 domain of CheA3 in complex with CheY6 from R. sphaeroides
Class: transferase
Keywords: protein-protein interaction, histidine kinase, response regulator, phosphorylation, specificity, Kinase, TRANSFERASE
Deposited on 2009-12-06, released 2010-02-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.172
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative histidine protein kinase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: cheA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLS0 (Start-135)
      • expression tag (136)
  • Chain 'B':
    Compound: CheY6 protein
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: cheY6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLS1 (12-144)
      • expression tag (10-11)
    Domains in SCOPe 2.03: d3kyjb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3kyjB (B:)
mrgshhhhhhgspynvmivddaammrlyiasfiktlpdfkvvaqaangqealdklaaqpn
vdlilldiempvmdgmeflrhaklktrakicmlssvavsgsphaararelgadgvvakps
gtvshdleektggelartmrtlmaa

    Sequence, based on observed residues (ATOM records): (download) 
    >3kyjB (B:)
gspynvmivddaammrlyiasfiktlpdfkvvaqaangqealdklaaqpnvdlilldiem
pvmdgmeflrhaklktrakicmlssvavsgsphaararelgadgvvakpsgtvktggela
rtmrtlmaa