PDB entry 3kyj

View 3kyj on RCSB PDB site
Description: Crystal structure of the P1 domain of CheA3 in complex with CheY6 from R. sphaeroides
Class: transferase
Keywords: protein-protein interaction, histidine kinase, response regulator, phosphorylation, specificity, Kinase, TRANSFERASE
Deposited on 2009-12-06, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative histidine protein kinase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: cheA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLS0 (Start-135)
      • expression tag (136)
  • Chain 'B':
    Compound: CheY6 protein
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: cheY6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLS1 (12-144)
      • expression tag (10-11)
    Domains in SCOPe 2.07: d3kyjb1, d3kyjb2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kyjB (B:)
    mrgshhhhhhgspynvmivddaammrlyiasfiktlpdfkvvaqaangqealdklaaqpn
    vdlilldiempvmdgmeflrhaklktrakicmlssvavsgsphaararelgadgvvakps
    gtvshdleektggelartmrtlmaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kyjB (B:)
    gspynvmivddaammrlyiasfiktlpdfkvvaqaangqealdklaaqpnvdlilldiem
    pvmdgmeflrhaklktrakicmlssvavsgsphaararelgadgvvakpsgtvktggela
    rtmrtlmaa