PDB entry 3kyd

View 3kyd on RCSB PDB site
Description: Human SUMO E1~SUMO1-AMP tetrahedral intermediate mimic
Class: ligase
Keywords: E1, SUMO, UBIQUITIN, THIOESTER, ADENYLATION, INHIBITOR, TETRAHEDRAL INTERMEDIATE, Ligase, Nucleus, Phosphoprotein, Ubl conjugation pathway, ATP-binding, Nucleotide-binding, Isopeptide bond, Membrane
Deposited on 2009-12-05, released 2010-02-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.23
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SUMO-activating enzyme subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: AOS1, SAE1, SUA1, UBLE1A
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: SUMO-activating enzyme subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HRIHFB2115, SAE2, UBA2, UBLE1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Gene: OK/SW-cl.43, SMT3C, SMT3H3, SUMO1, UBL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (Start-114)
      • engineered (113)
    Domains in SCOPe 2.03: d3kydd_
  • Heterogens: EDO, ZN, VMX, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >3kydD (D:)
mgsshhhhhhssglvprshmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmt
thlkklkesycqrqgvpmnslrflfegqriadnhtpkelgmeeedvievyqeqcg

    Sequence, based on observed residues (ATOM records): (download) 
    >3kydD (D:)
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqcg