PDB entry 3ky2

View 3ky2 on RCSB PDB site
Description: Crystal structure of Fibroblast Growth Factor Receptor 1 kinase domain
Class: transferase
Keywords: kinase, RTK, phosphorylation, interface, Alternative splicing, ATP-binding, Chromosomal rearrangement, Craniosynostosis, Disease mutation, Disulfide bond, Dwarfism, Glycoprotein, Heparin-binding, Hypogonadotropic hypogonadism, Immunoglobulin domain, Kallmann syndrome, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2009-12-04, released 2010-03-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.203
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, FGFBR, FLG, FLT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (9-End)
      • expression tag (7-8)
      • engineered (135)
    Domains in SCOPe 2.03: d3ky2a_
  • Chain 'B':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, FGFBR, FLG, FLT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ky2b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ky2A (A:)
    mghhhhhhmagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrv
    tkvavkmlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgn
    lreylqarrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarn
    vlvtednvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgv
    llweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfk
    qlvedldrivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ky2A (A:)
    hmagvseyelpedprwelprdrlvlgkplgeggqvvlaeaigldkdkpnrvtkvavkmlk
    sdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarr
    ppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvm
    kiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlg
    gspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldri
    valtsnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ky2B (B:)
    mghhhhhhmagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrv
    tkvavkmlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgn
    lreylqarrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarn
    vlvtednvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgv
    llweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfk
    qlvedldrivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ky2B (B:)
    vseyelpedprwelprdrlvlgkplgeggqvvlaeaigldkdkpnrvtkvavkmlksdat
    ekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrqlss
    kdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgladyykkttngrlp
    vkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkps
    nctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn