PDB entry 3kx9

View 3kx9 on RCSB PDB site
Description: Engineering a closed form of the Archaeoglobus fulgidus ferritin by site directed mutagenesis
Class: metal binding protein
Keywords: four-helix bundle, feroxidase center, tetracosamer, metal binding protein
Deposited on 2009-12-02, released 2010-12-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9a_
  • Chain 'B':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9b_
  • Chain 'C':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9c_
  • Chain 'D':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9d_
  • Chain 'E':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9e_
  • Chain 'F':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9f_
  • Chain 'G':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9g_
  • Chain 'H':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9h_
  • Chain 'I':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9i_
  • Chain 'J':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9j_
  • Chain 'K':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9k_
  • Chain 'L':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9l_
  • Chain 'M':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9m_
  • Chain 'N':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9n_
  • Chain 'O':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9o_
  • Chain 'P':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9p_
  • Chain 'Q':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9q_
  • Chain 'R':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9r_
  • Chain 'S':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9s_
  • Chain 'T':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9t_
  • Chain 'U':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9u_
  • Chain 'V':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9v_
  • Chain 'W':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9w_
  • Chain 'X':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0834, AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (149-150)
    Domains in SCOPe 2.05: d3kx9x_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kx9A (A:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9A (A:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kx9B (B:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9B (B:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kx9C (C:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9C (C:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kx9D (D:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9D (D:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqft
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3kx9E (E:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9E (E:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3kx9F (F:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9F (F:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3kx9G (G:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9G (G:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3kx9H (H:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9H (H:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3kx9I (I:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9I (I:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3kx9J (J:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9J (J:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3kx9K (K:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9K (K:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3kx9L (L:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9L (L:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3kx9M (M:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9M (M:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3kx9N (N:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9N (N:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3kx9O (O:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9O (O:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3kx9P (P:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9P (P:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3kx9Q (Q:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9Q (Q:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3kx9R (R:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9R (R:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3kx9S (S:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9S (S:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3kx9T (T:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9T (T:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3kx9U (U:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9U (U:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3kx9V (V:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9V (V:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3kx9W (W:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9W (W:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3kx9X (X:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedaaallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kx9X (X:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf