PDB entry 3kwx

View 3kwx on RCSB PDB site
Description: Chemically modified Taka alpha-amylase
Class: hydrolase
Keywords: HYDROLASE(O-GLYCOSYL), 1,4-alpha-D-glucan glucanohydrolase, CHEMICAL MODIFICATION, ARGININEMETHYLESTER, Carbohydrate metabolism, Disulfide bond, Glycoprotein, Glycosidase, Hydrolase, Metal-binding
Deposited on 2009-12-01, released 2009-12-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.177
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-amylase A type-1/2
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3kwxa1, d3kwxa2
  • Heterogens: CA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kwxA (A:)
    atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
    witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
    nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
    dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
    pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
    fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
    liasanairnyaiskdtgfvtyknwpiykddttiamrkgtdgsqivtilsnkgasgdsyt
    lslsgagytagqqltevigcttvtvgsdgnvpvpmagglprvlypteklagskicsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kwxA (A:)
    atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
    witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
    nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
    dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
    pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
    fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
    liasanairnyaiskdtgfvtyknwpiykddttiamrkgtdgsqivtilsnkgasgdsyt
    lslsgagytagqqltevigcttvtvgsdgnvpvpmagglprvlypteklagskics