PDB entry 3kwt

View 3kwt on RCSB PDB site
Description: munc13-1 c2b-domain, calcium-free
Deposited on 2009-12-01, released 2010-02-16
Made obsolete by 6nyc on 2019-02-20

The last revision was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Munc13-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: unc-13, Unc13a, Unc13h1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, B3P, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3kwtA (A:)
efavkqsvldgtskwsakisitvvcaqglqakdktgssdpyvtvqvgktkkrtktiygnl
npvweenfhfechnssdrikvrvldedddiksrvkqrfkresddflgqtiievrtlsgem
dvwynldkrtdksavsgairlhisveik

    Sequence, based on observed residues (ATOM records):
    >3kwtA (A:)
sakisitvvcaqglqakdgssdpyvtvqvgktkkrtktiygnlnpvweenfhfechnssd
rikvrvldedddikesddflgqtiievrtlsgemdvwynldkrvsgairlhisvei