PDB entry 3kvt

View 3kvt on RCSB PDB site
Description: tetramerization domain from akv3.1 (shaw-subfamily) voltage-gated potassium channel
Class: potassium channel
Keywords: potassium channel, tetramerization domain, molecular recognition, zinc-binding
Deposited on 1998-09-25, released 1999-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: potassium channel protein shaw
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76457
      • conflict (7-8)
      • engineered (36-38)
      • conflict (43)
      • conflict (59-60)
      • conflict (65)
      • conflict (85)
    Domains in SCOPe 2.06: d3kvta_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3kvtA (A:)
mdaenrviinvggirhetykatlkkipatrlsrltegmlnydpvlneyffdrhpgvfaqi
inyyrsgklhyptdvcgplfeeelefwgldsnqvepccwmtytahrdtqetlavl

    Sequence, based on observed residues (ATOM records): (download) 
    >3kvtA (A:)
enrviinvggirhetykatlkkipatrlsrltegmlnydpvlneyffdrhpgvfaqiiny
yrsgklhyptdvcgplfeeelefwgldsnqvepccwmtytahr