PDB entry 3kvt
View 3kvt on RCSB PDB site
Description: tetramerization domain from akv3.1 (shaw-subfamily) voltage-gated potassium channel
Class: potassium channel
Keywords: potassium channel, tetramerization domain, molecular recognition, zinc-binding
Deposited on
1998-09-25, released
1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: potassium channel protein shaw
Species: Aplysia californica [TaxId:6500]
Database cross-references and differences (RAF-indexed):
- Uniprot O76457
- conflict (7-8)
- engineered (36-38)
- conflict (43)
- conflict (59-60)
- conflict (65)
- conflict (85)
Domains in SCOPe 2.08: d3kvta_ - Heterogens: ZN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3kvtA (A:)
mdaenrviinvggirhetykatlkkipatrlsrltegmlnydpvlneyffdrhpgvfaqi
inyyrsgklhyptdvcgplfeeelefwgldsnqvepccwmtytahrdtqetlavl
Sequence, based on observed residues (ATOM records): (download)
>3kvtA (A:)
enrviinvggirhetykatlkkipatrlsrltegmlnydpvlneyffdrhpgvfaqiiny
yrsgklhyptdvcgplfeeelefwgldsnqvepccwmtytahr