PDB entry 3kv1

View 3kv1 on RCSB PDB site
Description: Crystal Structure of Putative Sugar-Binding Domain of Transcriptional Repressor from Vibrio fischeri
Class: transcription
Keywords: alpha-beta structure, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Transcription
Deposited on 2009-11-28, released 2009-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.168
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional Repressor
    Species: Vibrio fischeri [TaxId:312309]
    Gene: lsrR, VF_A0400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kv1a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kv1A (A:)
    snafhpvysvqleqklvekfnlkralisldqpntneqrkqvaalvssylnnnlqegmava
    vgqgqnvaavadhagivtqrnarfvsaiggthrsgdiinadhicrrlakkyggssetlya
    payvndpslrsafmehatiketlsqarkaefalvgigdmdenshmvklgfftpkefvear
    lndgivgdiggfdffkldgtdadtlmrgrviglemedlrqipnvvamasesrkalsimga
    lrtgvidvlatsvscamallnlaenee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kv1A (A:)
    svqleqklvekfnlkralisldqpntneqrkqvaalvssylnnnlqegmavavgqgqnva
    avadhagivtqrnarfvsaiggthiinadhicrrlakkyggssetlyapayvndpslrsa
    fmehatiketlsqarkaefalvgigdmdenshmvklgfftpkefvearlndgivgdiggf
    dffkldgtdadtlmrgrviglemedlrqipnvvamasesrkalsimgalrtgvidvlats
    vscamallnlaen