PDB entry 3kuz

View 3kuz on RCSB PDB site
Description: Crystal structure of the ubiquitin like domain of PLXNC1
Class: signaling protein
Keywords: plexin, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2009-11-28, released 2009-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plexin-C1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLXNC1, VESPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60486 (18-125)
      • expression tag (16-17)
    Domains in SCOPe 2.07: d3kuza1, d3kuza2
  • Chain 'B':
    Compound: Plexin-C1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLXNC1, VESPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60486 (18-125)
      • expression tag (17)
    Domains in SCOPe 2.07: d3kuzb1, d3kuzb2
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kuzA (A:)
    mhhhhhhssgrenlyfqgtvalnvvfekipenesadvcrnisvnvldcdtigqakekifq
    aflskngspyglqlneiglelqmgtrqkelldidsssviledgitklntighyeisngst
    ikvfkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kuzA (A:)
    qgtvalnvvfekipenesadvcrnisvnvldcdtigqakekifqaflskngspyglqlne
    iglelqmgtrqkelldidsssviledgitklntighyeisngstikvfkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kuzB (B:)
    mhhhhhhssgrenlyfqgtvalnvvfekipenesadvcrnisvnvldcdtigqakekifq
    aflskngspyglqlneiglelqmgtrqkelldidsssviledgitklntighyeisngst
    ikvfkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kuzB (B:)
    gtvalnvvfekipenesadvcrnisvnvldcdtigqakekifqaflskngspyglqlnei
    glelqmgtrqkelldidsssviledgitklntighyeisngstikvfkk