PDB entry 3kuc

View 3kuc on RCSB PDB site
Description: Complex of Rap1A(E30D/K31E)GDP with RafRBD(A85K/N71R)
Class: GTP binding protein/Transferase
Keywords: Ras-effector complex, GTP-binding, Nucleotide-binding, Proto-oncogene, Transferase, GTP binding protein-Transferase complex
Deposited on 2009-11-27, released 2010-03-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.176
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related protein rap-1a
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1A, KREV1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62834 (0-166)
      • engineered (29-30)
    Domains in SCOPe 2.05: d3kuca_
  • Chain 'B':
    Compound: raf proto-oncogene serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: RAF1, RAF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04049 (Start-80)
      • engineered (20)
      • engineered (34)
    Domains in SCOPe 2.05: d3kucb_
  • Heterogens: GDP, MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3kucA (A:)
    mreyklvvlgsggvgksaltvqfvqgifvdeydptiedsyrkqvevdcqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcdl
    edervvgkeqgqnlarqwcncaflessakskinvneifydlvrqinr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kucB (B:)
    psktsntirvflpnkqrtvvrvrngmslhdclmkklkvrglqpeccavfrllhehkgkka
    rldwntdaasligeelqvdfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kucB (B:)
    ntirvflpnkqrtvvrvrngmslhdclmkklkvrglqpeccavfrllhehkgkkarldwn
    tdaasligeelqvdfl