PDB entry 3ktq

View 3ktq on RCSB PDB site
Description: crystal structure of an active ternary complex of the large fragment of dna polymerase i from thermus aquaticus
Deposited on 1998-07-28, released 1999-01-13
The last revision prior to the SCOP 1.59 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ktqA (A:)
    aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargll
    akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
    fanlwgrlegeerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarlea
    evfrlaghpfnlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpiveki
    lqyreltklkstyidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgq
    rirrafiaeegwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpre
    avdplmrraaktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektle
    egrrrgyvetlfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprl
    eemgarmllqvhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsak